Lineage for d4lzda3 (4lzd A:290-494)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3006866Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 3006867Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families) (S)
  5. 3007364Family d.218.1.0: automated matches [227287] (1 protein)
    not a true family
  6. 3007365Protein automated matches [227105] (6 species)
    not a true protein
  7. 3007371Species Human (Homo sapiens) [TaxId:9606] [226559] (18 PDB entries)
  8. 3007382Domain d4lzda3: 4lzd A:290-494 [266712]
    Other proteins in same PDB: d4lzda1, d4lzda2
    automated match to d2ihma3
    complexed with cl, edo, imd, na

Details for d4lzda3

PDB Entry: 4lzd (more details), 1.85 Å

PDB Description: human dna polymerase mu- apoenzyme
PDB Compounds: (A:) DNA-directed DNA/RNA polymerase mu

SCOPe Domain Sequences for d4lzda3:

Sequence, based on SEQRES records: (download)

>d4lzda3 d.218.1.0 (A:290-494) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vlrsdvdalqqvveeavgqalpgatvtltggfrrgklqghdvdflithpkegqeagllpr
vmcrlqdqglilyhqhqhsccesptrlaqqshmdafersfcifrlpqpgswkavrvdlvv
apvsqfpfallgwtgsklfqrelrrfsrkekglwlnshglfdpeqktffqaaseedifrh
lgleylppeqrna

Sequence, based on observed residues (ATOM records): (download)

>d4lzda3 d.218.1.0 (A:290-494) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vlrsdvdalqqvveeavgqalpgatvtltggfrrgklqghdvdflithpkegqeagllpr
vmcrlqdqglilyhqhqhschmdafersfcifrlpqpgswkavrvdlvvapvsqfpfall
gwtgsklfqrelrrfsrkekglwlnshglfdpeqktffqaaseedifrhlgleylppeqr
na

SCOPe Domain Coordinates for d4lzda3:

Click to download the PDB-style file with coordinates for d4lzda3.
(The format of our PDB-style files is described here.)

Timeline for d4lzda3: