Lineage for d4lpwa_ (4lpw A:)
- Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.2: Fibronectin type III [49265] (2 families) 
Family b.1.2.0: automated matches [191562] (1 protein)
not a true familyProtein automated matches [190976] (4 species)
not a true protein
Species Artificial gene [TaxId:32630] [233328] (6 PDB entries) 
Domain d4lpwa_: 4lpw A: [236449]
automated match to d1tena_
Details for d4lpwa_
PDB Entry: 4lpw (more details), 2.8 Å
PDB Description: Crystal structure of TENCON variant A6
PDB Compounds: (A:) TENCON variant A6SCOPe Domain Sequences for d4lpwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lpwa_ b.1.2.0 (A:) automated matches {Artificial gene [TaxId: 32630]}
lpapknlvvsevtedslrlswtapdaafdsfliqyqesekvgeainltvpgsersydltg
lkpgteytvsiygvfpyqytmsnplsaefttgg
SCOPe Domain Coordinates for d4lpwa_:
Click to download the PDB-style file with coordinates for d4lpwa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4lpwa_:
- d4lpwa_ first appeared in SCOPe 2.03
- d4lpwa_ appears in SCOPe 2.04
- d4lpwa_ is called d4lpwa1 in SCOPe 2.06
- d4lpwa_ appears in the current release, SCOPe 2.08, called d4lpwa1
View in 3D
