Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) |
Family b.1.2.0: automated matches [191562] (1 protein) not a true family |
Protein automated matches [190976] (2 species) not a true protein |
Species Artificial gene [TaxId:32630] [233328] (6 PDB entries) |
Domain d4lpta_: 4lpt A: [236444] automated match to d2cuma1 |
PDB Entry: 4lpt (more details), 2.54 Å
SCOPe Domain Sequences for d4lpta_:
Sequence, based on SEQRES records: (download)
>d4lpta_ b.1.2.0 (A:) automated matches {Artificial gene [TaxId: 32630]} papknlvvsevtedslrlswtapdaafdsfliqyqesekvgeainltvpgsersydltgl kpgteytvsiygvlgsyvfehdvmlplsaefttggh
>d4lpta_ b.1.2.0 (A:) automated matches {Artificial gene [TaxId: 32630]} papknlvvsevtedslrlswtapdaafdsfliqyqeseeainltvpgsersydltglkpg teytvsiygvlgsyvfehdvmlplsaefttggh
Timeline for d4lpta_: