SCOPe 2.03: Domain d4lnkc1: 4lnk C:2-104

Lineage for d4lnkc1 (4lnk C:2-104)

Root: SCOPe 2.03
Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (2 families)
automatically mapped to Pfam PF03951
Family d.15.9.0: automated matches [227156] (1 protein)
not a true family
Protein automated matches [226862] (3 species)
not a true protein
Species Bacillus subtilis [TaxId:1423] [228697] (4 PDB entries)
Domain d4lnkc1: 4lnk C:2-104 [228698]
Other proteins in same PDB: d4lnka2, d4lnkb2, d4lnkc2, d4lnkd2, d4lnke2, d4lnkf2
automated match to d1f52a1
complexed with adp, glu, mg, so4

Details for d4lnkc1

PDB Entry: 4lnk (more details), 2.87 Å

PDB Description: b. subtilis glutamine synthetase structures reveal large active site conformational changes and basis for isoenzyme specific regulation: structure of gs-glutamate-amppcp complex

PDB Compounds: (C:) glutamine synthetase

SCOPe Domain Sequences for d4lnkc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lnkc1 d.15.9.0 (C:2-104) automated matches {Bacillus subtilis [TaxId: 1423]}
akytredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegfv
rieesdmylypdlntfvifpwtaekgkvarficdiynpdgtpf

SCOPe Domain Coordinates for d4lnkc1:

Click to download the PDB-style file with coordinates for d4lnkc1.
(The format of our PDB-style files is described here.)

Timeline for d4lnkc1: