Lineage for d4ln1d1 (4ln1 D:1-147)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2102557Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2102558Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2106799Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2106800Protein automated matches [190069] (239 species)
    not a true protein
  7. 2106963Species Bacillus cereus [TaxId:226900] [189455] (5 PDB entries)
  8. 2106967Domain d4ln1d1: 4ln1 D:1-147 [224718]
    Other proteins in same PDB: d4ln1a2, d4ln1a3, d4ln1b2, d4ln1b3, d4ln1c2, d4ln1c3, d4ln1d2, d4ln1d3
    automated match to d1ldna1
    complexed with ca

Details for d4ln1d1

PDB Entry: 4ln1 (more details), 1.9 Å

PDB Description: crystal structure of l-lactate dehydrogenase from bacillus cereus atcc 14579 complexed with calcium, nysgrc target 029452
PDB Compounds: (D:) L-lactate dehydrogenase 1

SCOPe Domain Sequences for d4ln1d1:

Sequence, based on SEQRES records: (download)

>d4ln1d1 c.2.1.0 (D:1-147) automated matches {Bacillus cereus [TaxId: 226900]}
mkkginrvvlvgtgavgcsyaycminqavaeefvlvdvneakaegeamdlshavpfapap
trvwkgsyedckdadlvvitaglpqkpgetrldlveknakifkqivrsimdsgfdgifli
atnpvdiltyvtwkesglpkervigsg

Sequence, based on observed residues (ATOM records): (download)

>d4ln1d1 c.2.1.0 (D:1-147) automated matches {Bacillus cereus [TaxId: 226900]}
mkkginrvvlvgtgavgcsyaycminqavaeefvlvdvneakaegeamdlshavpfapap
trvwkgsyedckdadlvvitaglprldlveknakifkqivrsimdsgfdgifliatnpvd
iltyvtwkesglpkervigsg

SCOPe Domain Coordinates for d4ln1d1:

Click to download the PDB-style file with coordinates for d4ln1d1.
(The format of our PDB-style files is described here.)

Timeline for d4ln1d1: