Lineage for d4llub2 (4llu B:108-210)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1765207Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries)
  8. 1765896Domain d4llub2: 4llu B:108-210 [236459]
    automated match to d2hmic2
    complexed with act, so4

Details for d4llub2

PDB Entry: 4llu (more details), 2.16 Å

PDB Description: structure of pertuzumab fab with light chain clambda at 2.16a
PDB Compounds: (B:) Light chain CLAMBDA

SCOPe Domain Sequences for d4llub2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4llub2 b.1.1.0 (B:108-210) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gqpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpsk
qsnnkyaassylsltpeqwkshrsyscqvthegstvektvapt

SCOPe Domain Coordinates for d4llub2:

Click to download the PDB-style file with coordinates for d4llub2.
(The format of our PDB-style files is described here.)

Timeline for d4llub2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4llub1