Lineage for d4lhvd_ (4lhv D:)
- Root: SCOPe 2.03
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) 
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
3 layers: a/b/a, parallel or mixed beta-sheets of variable sizesSuperfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) 
division into families based on beta-sheet topologies
Family c.37.1.8: G proteins [52592] (79 proteins)
core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the restProtein automated matches [190047] (16 species)
not a true protein
Species Mouse (Mus musculus) [TaxId:10090] [186896] (13 PDB entries) 
Domain d4lhvd_: 4lhv D: [228234]
automated match to d3bc1a_
complexed with gdp, mg
Details for d4lhvd_
PDB Entry: 4lhv (more details), 1.95 Å
PDB Description: Crystal structure of Rab8 in its inactive GDP-bound form
PDB Compounds: (D:) Ras-related protein Rab-8ASCOPe Domain Sequences for d4lhvd_:
Sequence, based on SEQRES records: (download)
>d4lhvd_ c.37.1.8 (D:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dylfkllligdsgvgktcvlfrfsedafnstfistigidfkirtieldgkriklqiwdta
gqerfrtittayyrgamgimlvyditneksfdnirnwirnieehasadvekmilgnkcdv
ndkrqvskergeklaldygikfmetsakaninvenafftlardikakmdkk
Sequence, based on observed residues (ATOM records): (download)
>d4lhvd_ c.37.1.8 (D:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dylfkllligdsgvgktcvlfrfsedafnstfistidfkirtieldgkriklqiwdtayy
rgamgimlvyditneksfdnirnwirnieehasadvekmilgnkcdvndkrqvskergek
laldygikfmetsakaninvenafftlardikakmdkk
SCOPe Domain Coordinates for d4lhvd_:
Click to download the PDB-style file with coordinates for d4lhvd_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4lhvd_:
- d4lhvd_ is new in SCOPe 2.03-stable
- d4lhvd_ appears in SCOPe 2.04
- d4lhvd_ appears in the current release, SCOPe 2.08
View in 3D
