Lineage for d4lfea_ (4lfe A:)
- Root: SCOPe 2.05
Class a: All alpha proteins [46456] (286 folds) 
Fold a.128: Terpenoid synthases [48575] (1 superfamily)
multihelical; core: 8 helices (C-J) are arranged in 2 parallel layersSuperfamily a.128.1: Terpenoid synthases [48576] (6 families) 
duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-JFamily a.128.1.0: automated matches [196408] (1 protein)
not a true familyProtein automated matches [196409] (30 species)
not a true protein
Species Streptococcus uberis [TaxId:218495] [235348] (2 PDB entries) 
Domain d4lfea_: 4lfe A: [235349]
automated match to d3ucaa_
complexed with ipe, mg
Details for d4lfea_
PDB Entry: 4lfe (more details), 1.95 Å
PDB Description: Crystal structure of geranylgeranyl diphosphate synthase sub1274 (target efi-509455) from streptococcus uberis 0140j with bound magnesium and isopentyl diphosphate, partially liganded complex;
PDB Compounds: (A:) Geranylgeranyl diphosphate synthaseSCOPe Domain Sequences for d4lfea_:
Sequence, based on SEQRES records: (download)
>d4lfea_ a.128.1.0 (A:) automated matches {Streptococcus uberis [TaxId: 218495]}
smdklkkidqtihafycekaviseklneavlysinaggkrirpilfleviealqipltes
hfkaaaalemihtgslihddlpamdnddyrrgqltnhkkfdeatailagdslfldafgml
aetdfptdvtvdlvrslssasgtfgmvggqmldmaaegkklnlknlqlihrhktgqllay
pfwaaarvaqldenllatfleigmiiglafqvrddilditanfeeigktpkkdvmaekmt
yphllglnesyqildesldqaeailrklsdeiafapqkilslierlrlda
Sequence, based on observed residues (ATOM records): (download)
>d4lfea_ a.128.1.0 (A:) automated matches {Streptococcus uberis [TaxId: 218495]}
smdklkkidqtihafycekaviseklneavlysinaggkrirpilfleviealqipltes
hfkaaaalemihtgslihddlpamdnddyrrgqltnhkkfdeatailagdslfldafgml
aetdfptdvtvdlvrslssasgtfgmvggqmldmaaegkklnlknlqlihrhktgqllay
pfwaaarvaqldenllatfleigmiiglafqvrddilditakmtyphllglnesyqilde
sldqaeailrklsdeiafapqkilslierlrlda
SCOPe Domain Coordinates for d4lfea_:
Click to download the PDB-style file with coordinates for d4lfea_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4lfea_:
- d4lfea_ first appeared in SCOPe 2.03
- d4lfea_ appears in SCOPe 2.04
- d4lfea_ is called d4lfea1 in SCOPe 2.06
- d4lfea_ appears in the current release, SCOPe 2.08, called d4lfea1
View in 3D
