Lineage for d4lf2a2 (4lf2 A:139-457)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2100572Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families) (S)
    automatically mapped to Pfam PF00016
  5. 2100573Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (2 proteins)
    N-terminal domain is alpha+beta
  6. 2100772Protein automated matches [226984] (9 species)
    not a true protein
  7. 2100919Species Rhodopseudomonas palustris [TaxId:258594] [257017] (3 PDB entries)
  8. 2100920Domain d4lf2a2: 4lf2 A:139-457 [266660]
    Other proteins in same PDB: d4lf2a1, d4lf2b1, d4lf2c1, d4lf2d1, d4lf2e1, d4lf2f1
    automated match to d4lf1a2
    complexed with co3, mg, so4

Details for d4lf2a2

PDB Entry: 4lf2 (more details), 2.38 Å

PDB Description: hexameric form ii rubisco from rhodopseudomonas palustris, activated and complexed with sulfate and magnesium
PDB Compounds: (A:) Ribulose bisphosphate carboxylase

SCOPe Domain Sequences for d4lf2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lf2a2 c.1.14.1 (A:139-457) automated matches {Rhodopseudomonas palustris [TaxId: 258594]}
gpsttikdlwrvlgrpvinggfivgtiikpklglrpqpfanacydfwlggdfikndepqg
nqvfapfkdtvravadamrraqdktgeaklfsfnitaddhyemlargefiletfadnadh
iaflvdgyvagpaavttarrafpkqylhyhraghgavtspqskrgytafvlskmarlqga
sgihtgtmgfgkmegeaadraiaymitedaadgpyfhqewlgmnpttpiisggmnalrmp
gffdnlghsnlimtagggafghvdggaagakslrqaeqcwkqgadpvefakdhrefaraf
esfpqdadklypnwraklk

SCOPe Domain Coordinates for d4lf2a2:

Click to download the PDB-style file with coordinates for d4lf2a2.
(The format of our PDB-style files is described here.)

Timeline for d4lf2a2: