Lineage for d4lega_ (4leg A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2173267Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2173268Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2174174Family d.3.1.0: automated matches [191342] (1 protein)
    not a true family
  6. 2174175Protein automated matches [190230] (20 species)
    not a true protein
  7. 2174196Species Human (Homo sapiens) [TaxId:9606] [187072] (42 PDB entries)
  8. 2174268Domain d4lega_: 4leg A: [236776]
    automated match to d3of8a_
    complexed with 1xf, act, gol, so4; mutant

Details for d4lega_

PDB Entry: 4leg (more details), 2.6 Å

PDB Description: human cathepsin k mutant c25s in complex with an allosteric modifier
PDB Compounds: (A:) cathepsin k

SCOPe Domain Sequences for d4lega_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lega_ d.3.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
yipewegrapdsvdyrkkgyvtpvknqgqcgsswafssvgalegqlkkktgkllnlspqn
lvdcvsendgcgggymtnafqyvqknrgidsedaypyvgqeescmynptgkaakcrgyre
ipegnekalkravarvgpvsvaidasltsfqfyskgvyydescnsdnlnhavlavgygiq
kgnkhwiiknswgenwgnkgyilmarnknnacgianlasfpkm

SCOPe Domain Coordinates for d4lega_:

Click to download the PDB-style file with coordinates for d4lega_.
(The format of our PDB-style files is described here.)

Timeline for d4lega_: