Lineage for d4le0b_ (4le0 B:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345Superfamily c.23.1: CheY-like [52172] (8 families) 
Family c.23.1.0: automated matches [191324] (1 protein)
not a true familyProtein automated matches [190131] (86 species)
not a true protein
Species Bacillus subtilis [TaxId:224308] [257830] (6 PDB entries) 
Domain d4le0b_: 4le0 B: [266656]
automated match to d4le2a_
protein/DNA complex; complexed with act, bef, gol, mg
Details for d4le0b_
PDB Entry: 4le0 (more details), 2.27 Å
PDB Description: crystal structure of the receiver domain of desr in complex with beryllofluoride and magnesium
PDB Compounds: (B:) Transcriptional regulatory protein DesRSCOPe Domain Sequences for d4le0b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4le0b_ c.23.1.0 (B:) automated matches {Bacillus subtilis [TaxId: 224308]}
misifiaedqqmllgalgsllnleddmevvgkgttgqdavdfvkkrqpdvcimdiempgk
tgleaaeelkdtgckiiilttfarpgyfqraikagvkgyllkdspseelanairsvmngk
riyapelmedlys
SCOPe Domain Coordinates for d4le0b_:
Click to download the PDB-style file with coordinates for d4le0b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4le0b_:
- d4le0b_ first appeared in SCOPe 2.05
- d4le0b_ appears in SCOPe 2.07
View in 3D
