Lineage for d4lcwa1 (4lcw A:0-178)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1641761Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1641762Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 1642705Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 1642706Protein automated matches [226842] (4 species)
    not a true protein
  7. 1642719Species Human (Homo sapiens) [TaxId:9606] [226044] (26 PDB entries)
  8. 1642733Domain d4lcwa1: 4lcw A:0-178 [228083]
    Other proteins in same PDB: d4lcwa2, d4lcwb_, d4lcwc2, d4lcwd1, d4lcwd2, d4lcwe1, d4lcwe2, d4lcwf_, d4lcwg1, d4lcwg2, d4lcwh1, d4lcwh2
    automated match to d2bcka2
    complexed with 1vy, gol

Details for d4lcwa1

PDB Entry: 4lcw (more details), 2.4 Å

PDB Description: The structure of human MAIT TCR in complex with MR1-K43A-RL-6-Me-7OH
PDB Compounds: (A:) Major histocompatibility complex class I-related gene protein

SCOPe Domain Sequences for d4lcwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lcwa1 d.19.1.0 (A:0-178) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mrthslryfrlgvsdpihgvpefisvgyvdshpittydsvtrqaeprapwmaenlapdhw
erytqllrgwqqmfkvelkrlqrhynhsgshtyqrmigcelledgsttgflqyaydgqdf
lifnkdtlswlavdnvahtikqaweanqhellyqknwleeeciawlkrfleygkdtlqr

SCOPe Domain Coordinates for d4lcwa1:

Click to download the PDB-style file with coordinates for d4lcwa1.
(The format of our PDB-style files is described here.)

Timeline for d4lcwa1: