Lineage for d4larh_ (4lar H:)
- Root: SCOPe 2.03
Class b: All beta proteins [48724] (174 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) Protein automated matches [190119] (16 species)
not a true protein
Species Mouse (Mus musculus) [TaxId:10090] [186842] (99 PDB entries) 
Domain d4larh_: 4lar H: [229663]
Other proteins in same PDB: d4larl_
automated match to d1dl7h_
complexed with 1we
Details for d4larh_
PDB Entry: 4lar (more details), 2.38 Å
PDB Description: crystal structure of a therapeutic single chain antibody in complex with amphetamine
PDB Compounds: (H:) Single heavy chain Variable fragmentSCOPe Domain Sequences for d4larh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4larh_ b.1.1.1 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evqlqesgpslvkpsqtlsltcsvtgdsvtsgywswirqfpgnkldymgyisyrgstyyn
pslksrisitrdtsknqvylqlksvssedtatyycsyfdsddyameywgqgtsvtvs
SCOPe Domain Coordinates for d4larh_:
Click to download the PDB-style file with coordinates for d4larh_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4larh_:
- d4larh_ is new in SCOPe 2.03-stable
- d4larh_ appears in SCOPe 2.04
- d4larh_ appears in the current release, SCOPe 2.08
View in 3D
