Lineage for d4la9a_ (4la9 A:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the restSuperfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) 
Similar in architecture to the superfamily I but partly differs in topology
Family c.94.1.0: automated matches [191309] (1 protein)
not a true familyProtein automated matches [190039] (161 species)
not a true proteinSpecies Lactococcus lactis [TaxId:272623] [227880] (6 PDB entries) 
Domain d4la9a_: 4la9 A: [227892]
automated match to d3k4ue_
complexed with peg, po4
Details for d4la9a_
PDB Entry: 4la9 (more details), 1.3 Å
PDB Description: crystal structure of an empty substrate binding domain 1 (sbd1) of abc transporter glnpq from lactococcus lactis
PDB Compounds: (A:) Glutamine ABC transporter permease and substrate binding protein proteinSCOPe Domain Sequences for d4la9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4la9a_ c.94.1.0 (A:) automated matches {Lactococcus lactis [TaxId: 272623]}
aettvkiasdssyapfefqngqkkwvgidvdimqevakindwklemsypgfdaalqnlka
gqvdgiiagmtitderketfdfsnpyytsaltiattkdsklsdysdlkgkavgakngtaa
qtwlqenqkkygytiktysdgvhmfaalssgniagamdevpvisyamkqgqdlamnfpsi
slpggygfavmkgknstlvdgfnkalaemksngdydkilkkygita
SCOPe Domain Coordinates for d4la9a_:
Click to download the PDB-style file with coordinates for d4la9a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4la9a_:
- d4la9a_ first appeared in SCOPe 2.03
- d4la9a_ appears in SCOPe 2.07
View in 3D
