Lineage for d4l4vg2 (4l4v G:111-198)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1513476Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1517226Protein automated matches [190374] (9 species)
    not a true protein
  7. 1517240Species Human (Homo sapiens) [TaxId:9606] [187221] (385 PDB entries)
  8. 1517299Domain d4l4vg2: 4l4v G:111-198 [227537]
    Other proteins in same PDB: d4l4va1, d4l4va2, d4l4vb_, d4l4vc1, d4l4vc2, d4l4vd1, d4l4ve1, d4l4ve2, d4l4vf_, d4l4vg1, d4l4vh1, d4l4vh2
    automated match to d2f54d2
    complexed with 1vy, gol

Details for d4l4vg2

PDB Entry: 4l4v (more details), 1.9 Å

PDB Description: Structure of human MAIT TCR in complex with human MR1-RL-6-Me-7-OH
PDB Compounds: (G:) MAIT T-cell receptor alpha chain

SCOPe Domain Sequences for d4l4vg2:

Sequence, based on SEQRES records: (download)

>d4l4vg2 b.1.1.2 (G:111-198) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffp

Sequence, based on observed residues (ATOM records): (download)

>d4l4vg2 b.1.1.2 (G:111-198) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrsvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnf
acanafnnsiipedtffp

SCOPe Domain Coordinates for d4l4vg2:

Click to download the PDB-style file with coordinates for d4l4vg2.
(The format of our PDB-style files is described here.)

Timeline for d4l4vg2: