Details for d4l4tc1

PDB Entry: 4l4t (more details), 2 Å

PDB Compounds: (C:) Major histocompatibility complex class I-related gene protein

SCOPe Domain Sequences for d4l4tc1:

Sequence, based on SEQRES records: (download)

>d4l4tc1 d.19.1.0 (C:1-178) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rthslryfrlgvsdpihgvpefisvgyvdshpittydsvtrqkeprapwmaenlapdhwe
rytqllrgwqqmfkvelkrlqrhynhsgshtyqrmigcelledgsttgflqyaydgqdfl
ifnkdtlswlavdnvahtikqaweanqhellyqknwleeeciawlkrfleygkdtlqr

Sequence, based on observed residues (ATOM records): (download)

>d4l4tc1 d.19.1.0 (C:1-178) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rthslryfrlgvsdpivpefisvgyvdshpittydsvtrqkeprapwmaenlapdhwery
tqllrgwqqmfkvelkrlqrhynhsgshtyqrmigcelledgsttgflqyaydgqdflif
nkdtlswlavdnvahtikqaweanqhellyqknwleeeciawlkrfleygkdtlqr

SCOPe Domain Coordinates for d4l4tc1:

Timeline for d4l4tc1:

• d4l4tc1 first appeared in SCOPe 2.03
  
• d4l4tc1 appears in SCOPe 2.07
  

Thumbnails for d4l4tc1:

d4l4tc1 (click for larger image) View in 3D

d4l4tc1 in context of chain d4l4tc2 in context of chain d4l4tc3 in context of chain View in 3D Domains from same chain: (mouse over for more information) d4l4tc2, d4l4tc3

d4l4tc1 in context of PDB d4l4ta1 in context of PDB d4l4ta2 in context of PDB d4l4ta3 in context of PDB d4l4tb_ in context of PDB d4l4td1 in context of PDB d4l4td2 in context of PDB d4l4te1 in context of PDB d4l4te2 in context of PDB d4l4tf_ in context of PDB d4l4tg1 in context of PDB d4l4tg2 in context of PDB d4l4th1 in context of PDB d4l4th2 in context of PDB View in 3D Domains from other chains: (mouse over for more information) d4l4ta1, d4l4ta2, d4l4ta3, d4l4tb_, d4l4td1, d4l4td2, d4l4te1, d4l4te2, d4l4tf_, d4l4tg1, d4l4tg2, d4l4th1, d4l4th2