Lineage for d4l2ib_ (4l2i B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2861263Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 2861542Family c.26.2.0: automated matches [191320] (1 protein)
    not a true family
  6. 2861543Protein automated matches [190116] (28 species)
    not a true protein
  7. 2861547Species Acidaminococcus fermentans [TaxId:591001] [236033] (2 PDB entries)
  8. 2861548Domain d4l2ib_: 4l2i B: [237638]
    automated match to d4kpub_
    complexed with cl, fad, nad

Details for d4l2ib_

PDB Entry: 4l2i (more details), 1.45 Å

PDB Description: Electron transferring flavoprotein of Acidaminococcus fermentans: Towards a mechanism of flavin-based electron bifurcation
PDB Compounds: (B:) Electron transfer flavoprotein alpha/beta-subunit

SCOPe Domain Sequences for d4l2ib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4l2ib_ c.26.2.0 (B:) automated matches {Acidaminococcus fermentans [TaxId: 591001]}
mnivvcvkqvpdtaemkidpvtnnlvrdgvtnimnpydqyaletalqlkdelgahvtvit
mgpphaesvlrdclavgadeaklvsdrafggadtlatsaamantikhfgvpdlilcgrqa
idgdtaqvgpeiaehlglpqvtaalkvqvkddtvvvdrdneqmsmtftmkmpcvvtvmrs
kdlrfasirgkmkarkaeipvytaaaleipldiigkagsptqvmksftpkvtqvhgeifd
dedpavavdklvnkliedkiitk

SCOPe Domain Coordinates for d4l2ib_:

Click to download the PDB-style file with coordinates for d4l2ib_.
(The format of our PDB-style files is described here.)

Timeline for d4l2ib_: