SCOPe 2.04: Domain d4l2ca2: 4l2c A:83-192

Lineage for d4l2ca2 (4l2c A:83-192)

Root: SCOPe 2.04
Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families)
automatically mapped to Pfam PF02777
Family d.44.1.0: automated matches [227155] (1 protein)
not a true family
Protein automated matches [226860] (25 species)
not a true protein
Species Pseudoalteromonas haloplanktis [TaxId:228] [237182] (3 PDB entries)
Domain d4l2ca2: 4l2c A:83-192 [237183]
Other proteins in same PDB: d4l2ca1, d4l2cb1, d4l2cc1, d4l2cd1
automated match to d2p4ka2
complexed with fe, tre; mutant

Details for d4l2ca2

PDB Entry: 4l2c (more details), 1.66 Å

PDB Description: x-ray structure of the c57r mutant of the iron superoxide dismutase from pseudoalteromonas haloplanktis (crystal form i)

PDB Compounds: (A:) superoxide dismutase [fe]

SCOPe Domain Sequences for d4l2ca2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4l2ca2 d.44.1.0 (A:83-192) automated matches {Pseudoalteromonas haloplanktis [TaxId: 228]}
ngggaptgavadainakwgsfdafkealndkavnnfgsswtwlvkladgsldivntsnaa
tpltddgvtpiltvdlwehayyidyrnvrpdylkgfwslvnwefananfa

SCOPe Domain Coordinates for d4l2ca2:

Click to download the PDB-style file with coordinates for d4l2ca2.
(The format of our PDB-style files is described here.)

Timeline for d4l2ca2: