Lineage for d4kvme_ (4kvm E:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2968378Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2968379Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) (S)
  5. 2968970Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 2968971Protein automated matches [190038] (49 species)
    not a true protein
  7. 2969410Species Schizosaccharomyces pombe [TaxId:284812] [311394] (3 PDB entries)
  8. 2969417Domain d4kvme_: 4kvm E: [307655]
    automated match to d4lx9a_
    complexed with 1xe, cl, so4

Details for d4kvme_

PDB Entry: 4kvm (more details), 2.6 Å

PDB Description: the nata (naa10p/naa15p) amino-terminal acetyltransferase complex bound to a bisubstrate analog
PDB Compounds: (E:) N-terminal acetyltransferase A complex catalytic subunit ard1

SCOPe Domain Sequences for d4kvme_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kvme_ d.108.1.0 (E:) automated matches {Schizosaccharomyces pombe [TaxId: 284812]}
mdirparisdltgmqncnlhnlpenyqlkyylyhaiswpmlsyvatdpkgrvvgyvlakm
eeepkdgiphghitsvsvmrsyrhlglakrlmvqsqramvevygakymslhvrksnraai
hlyrdtlqfdvqgieskyyadgedayamhkdfs

SCOPe Domain Coordinates for d4kvme_:

Click to download the PDB-style file with coordinates for d4kvme_.
(The format of our PDB-style files is described here.)

Timeline for d4kvme_: