Lineage for d4krla1 (4krl A:307-480)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1834683Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 1834752Superfamily c.10.2: L domain-like [52058] (9 families) (S)
    less regular structure consisting of variable repeats
  5. 1834828Family c.10.2.5: L domain [52071] (6 proteins)
    this is a repeat family; one repeat unit is 1n8z C:42-66 found in domain
  6. 1834879Protein automated matches [232361] (1 species)
    not a true protein
  7. 1834880Species Human (Homo sapiens) [TaxId:9606] [232384] (3 PDB entries)
  8. 1834889Domain d4krla1: 4krl A:307-480 [235219]
    Other proteins in same PDB: d4krla2, d4krlb_
    automated match to d3b2ua1
    complexed with iod, mes, nag

Details for d4krla1

PDB Entry: 4krl (more details), 2.85 Å

PDB Description: nanobody/vhh domain 7d12 in complex with domain iii of the extracellular region of egfr, ph 6.0
PDB Compounds: (A:) Epidermal growth factor receptor

SCOPe Domain Sequences for d4krla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4krla1 c.10.2.5 (A:307-480) automated matches {Human (Homo sapiens) [TaxId: 9606]}
leekkvcngigigefkdslsinatnikhfknctsisgdlhilpvafrgdsfthtppldpq
eldilktvkeitgflliqawpenrtdlhafenleiirgrtkqhgqfslavvslnitslgl
rslkeisdgdviisgnknlcyantinwkklfgtsgqktkiisnrgensckatgq

SCOPe Domain Coordinates for d4krla1:

Click to download the PDB-style file with coordinates for d4krla1.
(The format of our PDB-style files is described here.)

Timeline for d4krla1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4krla2
View in 3D
Domains from other chains:
(mouse over for more information)
d4krlb_