Lineage for d4krla1 (4krl A:307-480)
- Root: SCOPe 2.04
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
Superfamily c.10.2: L domain-like [52058] (9 families) 
less regular structure consisting of variable repeats
Family c.10.2.5: L domain [52071] (6 proteins)
this is a repeat family; one repeat unit is 1n8z C:42-66 found in domain
Protein automated matches [232361] (1 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [232384] (3 PDB entries) 
Domain d4krla1: 4krl A:307-480 [235219]
Other proteins in same PDB: d4krla2, d4krlb_
automated match to d3b2ua1
complexed with iod, mes, nag
Details for d4krla1
PDB Entry: 4krl (more details), 2.85 Å
PDB Description: nanobody/vhh domain 7d12 in complex with domain iii of the extracellular region of egfr, ph 6.0
PDB Compounds: (A:) Epidermal growth factor receptorSCOPe Domain Sequences for d4krla1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4krla1 c.10.2.5 (A:307-480) automated matches {Human (Homo sapiens) [TaxId: 9606]}
leekkvcngigigefkdslsinatnikhfknctsisgdlhilpvafrgdsfthtppldpq
eldilktvkeitgflliqawpenrtdlhafenleiirgrtkqhgqfslavvslnitslgl
rslkeisdgdviisgnknlcyantinwkklfgtsgqktkiisnrgensckatgq
SCOPe Domain Coordinates for d4krla1:
Click to download the PDB-style file with coordinates for d4krla1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4krla1:
- d4krla1 first appeared in SCOPe 2.03
- d4krla1 appears in SCOPe 2.05
- d4krla1 appears in the current release, SCOPe 2.08
View in 3D
