Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (3 superfamilies) 3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.44.3: PIWI domain N-terminal-like [310581] (2 families) |
Family c.44.3.0: automated matches [310677] (1 protein) not a true family |
Protein automated matches [310878] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [311393] (6 PDB entries) |
Domain d4krea2: 4kre A:411-575 [307648] Other proteins in same PDB: d4krea1, d4krea3 automated match to d4olaa2 protein/RNA complex |
PDB Entry: 4kre (more details), 1.75 Å
SCOPe Domain Sequences for d4krea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4krea2 c.44.3.0 (A:411-575) automated matches {Human (Homo sapiens) [TaxId: 9606]} lpapilqyggrnraiatpnqgvwdmrgkqfyngieikvwaiacfapqkqcreevlknftd qlrkiskdagmpiqgqpcfckyaqgadsvepmfrhlkntysglqliivilpgktpvyaev krvgdtllgmatqcvqvknvvktspqtlsnlclkinvklgginni
Timeline for d4krea2: