Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.108.1: HAD-like [56784] (26 families) usually contains an insertion (sub)domain after strand 1 |
Family c.108.1.0: automated matches [191369] (1 protein) not a true family |
Protein automated matches [190447] (55 species) not a true protein |
Species Geobacillus stearothermophilus [TaxId:1422] [229821] (4 PDB entries) |
Domain d4kn8b_: 4kn8 B: [238404] automated match to d1pw5a_ |
PDB Entry: 4kn8 (more details), 1.5 Å
SCOPe Domain Sequences for d4kn8b_:
Sequence, based on SEQRES records: (download)
>d4kn8b_ c.108.1.0 (B:) automated matches {Geobacillus stearothermophilus [TaxId: 1422]} mrkyngylidldgtmyrgteridaasgfikelnrlhipylfvtnnstrtpeqvadklvsl dipatpeqiftssmatanyvydldqnamiyfigeeglykalkekgfsfadenadvvivgl drevtyeklavaclavrngaklistngdlalptergfmpgngaftalishstqvkatfvg kpepiimeqalkvlgtnknetimvgdnydtdilagiragldtllvhtgvttveklkeykq qptysmkslddwkfl
>d4kn8b_ c.108.1.0 (B:) automated matches {Geobacillus stearothermophilus [TaxId: 1422]} mrkyngylidldgtmyaasgfikelnrlhipylfvtnnstrtpeqvadklvsldipatpe qiftssmatanyvydldqnamiyfigeeglykalkekgfsfadenadvvivgldrevtye klavaclavrngaklistngdlalptergfmpgngaftalishstqvkatfvgkpepiim eqalkvlgtnknetimvgdnydtdilagiragldtllvhtgvttveykqqptysmksldd wkfl
Timeline for d4kn8b_: