Lineage for d4kg8b_ (4kg8 B:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.22: TNF-like [49841] (1 superfamily)
sandwich, 10 strands in 2 sheets; jelly-rollSuperfamily b.22.1: TNF-like [49842] (2 families) 
Family b.22.1.0: automated matches [191519] (1 protein)
not a true familyProtein automated matches [190873] (4 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [188225] (28 PDB entries) 
Domain d4kg8b_: 4kg8 B: [235163]
automated match to d2re9a_
mutant
Details for d4kg8b_
PDB Entry: 4kg8 (more details), 2.25 Å
PDB Description: Crystal structure of light mutant
PDB Compounds: (B:) Tumor necrosis factor ligand superfamily member 14SCOPe Domain Sequences for d4kg8b_:
Sequence, based on SEQRES records: (download)
>d4kg8b_ b.22.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
npaahltganssltgsggpllwetqlglaflrglsyhdgalvvtkagyyyiyskvqlggv
gcplglastithglykrtprypeelellvsqqspcgratssssnwfdssflggvvhleag
eevvvrvlderlvrlrdgtrsyfgafmv
Sequence, based on observed residues (ATOM records): (download)
>d4kg8b_ b.22.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
npaahltganssgsggpllwetqlglaflrglsyhdgalvvtkagyyyiyskvqlgasti
thglykrtypeelellvsqqspnwfdssflggvvhleageevvvrvldegtrsyfgafmv
SCOPe Domain Coordinates for d4kg8b_:
Click to download the PDB-style file with coordinates for d4kg8b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4kg8b_:
- d4kg8b_ first appeared in SCOPe 2.03
- d4kg8b_ appears in SCOPe 2.07
View in 3D
