Lineage for d4kcxb_ (4kcx B:)
- Root: SCOPe 2.07
Class a: All alpha proteins [46456] (289 folds) 
Fold a.29: Bromodomain-like [47363] (15 superfamilies)
4 helices; bundle; minor mirror variant of up-and-down topologySuperfamily a.29.2: Bromodomain [47370] (2 families) 
Family a.29.2.0: automated matches [191428] (1 protein)
not a true familyProtein automated matches [190615] (14 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [187641] (1004 PDB entries) 
Domain d4kcxb_: 4kcx B: [227962]
automated match to d4a9ib_
complexed with 1qk, cl
Details for d4kcxb_
PDB Entry: 4kcx (more details), 2 Å
PDB Description: BRDT in complex with Dinaciclib
PDB Compounds: (B:) Bromodomain testis-specific proteinSCOPe Domain Sequences for d4kcxb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kcxb_ a.29.2.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tnqlqylqkvvlkdlwkhsfswpfqrpvdavklqlpdyytiiknpmdlntikkrlenkyy
akaseciedfntmfsncylynkpgddivlmaqaleklfmqklsqmp
SCOPe Domain Coordinates for d4kcxb_:
Click to download the PDB-style file with coordinates for d4kcxb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4kcxb_:
- d4kcxb_ first appeared in SCOPe 2.03
- d4kcxb_ appears in SCOPe 2.06
- d4kcxb_ appears in the current release, SCOPe 2.08
View in 3D
