SCOPe 2.08: Domain d4k71e2: 4k71 E:177-268

Lineage for d4k71e2 (4k71 E:177-268)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (15 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

Domain d4k71e2: 4k71 E:177-268 [228472]
Other proteins in same PDB: d4k71a1, d4k71a2, d4k71a3, d4k71b1, d4k71c_, d4k71d1, d4k71d2, d4k71d3, d4k71e1, d4k71f_
automated match to d3frua1
complexed with so4

Details for d4k71e2

PDB Entry: 4k71 (more details), 2.4 Å

PDB Description: Crystal structure of a high affinity Human Serum Albumin variant bound to the Neonatal Fc Receptor

PDB Compounds: (E:) igg receptor fcrn large subunit p51

SCOPe Domain Sequences for d4k71e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4k71e2 b.1.1.2 (E:177-268) automated matches {Human (Homo sapiens) [TaxId: 9606]}
keppsmrlkarpsspgfsvltcsafsfyppelqlrflrnglaagtgqgdfgpnsdgsfha
sssltvksgdehhyccivqhaglaqplrvele

SCOPe Domain Coordinates for d4k71e2:

Click to download the PDB-style file with coordinates for d4k71e2.
(The format of our PDB-style files is described here.)

Timeline for d4k71e2: