Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily) 8-stranded mixed beta-sheet; 2 layers: alpha/beta |
Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) |
Family d.122.1.0: automated matches [227160] (1 protein) not a true family |
Protein automated matches [226867] (13 species) not a true protein |
Species Enterococcus faecalis [TaxId:226185] [226590] (9 PDB entries) |
Domain d4k4oa_: 4k4o A: [236029] automated match to d4geea_ protein/DNA complex; complexed with doo, tbu |
PDB Entry: 4k4o (more details), 1.3 Å
SCOPe Domain Sequences for d4k4oa_:
Sequence, based on SEQRES records: (download)
>d4k4oa_ d.122.1.0 (A:) automated matches {Enterococcus faecalis [TaxId: 226185]} gleavrkrpgmyigstsgeglhhlvweivdnsidealagfaksiqviiepddsitviddg rgipvgiqaktgrpavetvftvlhaggkfggggykvsgglhgvgssvvnalstsldvrvy kdgkvyyqeyrrgavvddlkvieetdrhgttvhfipdpeiftettvydfdklatrvrela flnrglhisiedrregqedkkeyhyegleh
>d4k4oa_ d.122.1.0 (A:) automated matches {Enterococcus faecalis [TaxId: 226185]} gleavrkrpgmyigstsgeglhhlvweivdnsidealagfaksiqviiepddsitviddg rgipvgiqaktgrpavetvftvlgssvvnalstsldvrvykdgkvyyqeyrrgavvddlk vieetdrhgttvhfipdpeiftettvydfdklatrvrelaflnrglhisiedrregqedk keyhyegleh
Timeline for d4k4oa_: