Lineage for d4k4oa_ (4k4o A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1924588Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 1924589Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 1925132Family d.122.1.0: automated matches [227160] (1 protein)
    not a true family
  6. 1925133Protein automated matches [226867] (13 species)
    not a true protein
  7. 1925134Species Enterococcus faecalis [TaxId:226185] [226590] (9 PDB entries)
  8. 1925135Domain d4k4oa_: 4k4o A: [236029]
    automated match to d4geea_
    protein/DNA complex; complexed with doo, tbu

Details for d4k4oa_

PDB Entry: 4k4o (more details), 1.3 Å

PDB Description: The DNA Gyrase B ATP binding domain of Enterococcus faecalis in complex with a small molecule inhibitor
PDB Compounds: (A:) DNA gyrase subunit b

SCOPe Domain Sequences for d4k4oa_:

Sequence, based on SEQRES records: (download)

>d4k4oa_ d.122.1.0 (A:) automated matches {Enterococcus faecalis [TaxId: 226185]}
gleavrkrpgmyigstsgeglhhlvweivdnsidealagfaksiqviiepddsitviddg
rgipvgiqaktgrpavetvftvlhaggkfggggykvsgglhgvgssvvnalstsldvrvy
kdgkvyyqeyrrgavvddlkvieetdrhgttvhfipdpeiftettvydfdklatrvrela
flnrglhisiedrregqedkkeyhyegleh

Sequence, based on observed residues (ATOM records): (download)

>d4k4oa_ d.122.1.0 (A:) automated matches {Enterococcus faecalis [TaxId: 226185]}
gleavrkrpgmyigstsgeglhhlvweivdnsidealagfaksiqviiepddsitviddg
rgipvgiqaktgrpavetvftvlgssvvnalstsldvrvykdgkvyyqeyrrgavvddlk
vieetdrhgttvhfipdpeiftettvydfdklatrvrelaflnrglhisiedrregqedk
keyhyegleh

SCOPe Domain Coordinates for d4k4oa_:

Click to download the PDB-style file with coordinates for d4k4oa_.
(The format of our PDB-style files is described here.)

Timeline for d4k4oa_: