Lineage for d4k2ac_ (4k2a C:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1869037Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1869038Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1871035Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 1871036Protein automated matches [190543] (71 species)
    not a true protein
  7. 1871111Species Bradyrhizobium elkanii [TaxId:29448] [256834] (1 PDB entry)
  8. 1871114Domain d4k2ac_: 4k2a C: [257790]
    automated match to d3sk0a_
    complexed with act, cl

Details for d4k2ac_

PDB Entry: 4k2a (more details), 2.2 Å

PDB Description: Crystal structure of haloalkane dehalogenase DbeA from Bradyrhizobium elkani USDA94
PDB Compounds: (C:) haloalkane dehalogenase

SCOPe Domain Sequences for d4k2ac_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4k2ac_ c.69.1.0 (C:) automated matches {Bradyrhizobium elkanii [TaxId: 29448]}
dislhhravlgstmayretgrsdaphvlflhgnptssyiwrnimplvapvghciapdlig
ygqsgkpdisyrffdqadyldalidelgiasaylvaqdwgtalafhlaarrpqlvrglaf
mefirpmrdwsdfhqhdaaretfrkfrtpgvgeamildnnafvervlpgsilrtlseeem
aayrapfatresrmptlmlprelpiagepadvtqaltaahaalaastypkllfvgspgal
vspafaaefaktlkhcaviqlgagghylqedhpeaigrsvagwiagieaasaqrhaale

SCOPe Domain Coordinates for d4k2ac_:

Click to download the PDB-style file with coordinates for d4k2ac_.
(The format of our PDB-style files is described here.)

Timeline for d4k2ac_: