Lineage for d4jvla_ (4jvl A:)
- Root: SCOPe 2.06
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
3 layers: a/b/a, parallel or mixed beta-sheets of variable sizesSuperfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) 
division into families based on beta-sheet topologies
Family c.37.1.5: PAPS sulfotransferase [52575] (15 proteins)
Pfam PF00685
similar to the nucleotide/nucleoside kinases but transfer sulphate group
Protein Estrogen sulfotransferase (STE, sult1e1) [52576] (2 species) 
Species Human (Homo sapiens) [TaxId:9606] [75198] (5 PDB entries) 
Domain d4jvla_: 4jvl A: [227731]
automated match to d1hy3a_
complexed with a3p, edo, est, na
Details for d4jvla_
PDB Entry: 4jvl (more details), 1.94 Å
PDB Description: Crystal structure of human estrogen sulfotransferase (SULT1E1) in complex with inactive cofactor PAP and estradiol (E2)
PDB Compounds: (A:) estrogen sulfotransferaseSCOPe Domain Sequences for d4jvla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jvla_ c.37.1.5 (A:) Estrogen sulfotransferase (STE, sult1e1) {Human (Homo sapiens) [TaxId: 9606]}
nseldyyekfeevhgilmykdfvkywdnveafqarpddlviatypksgttwvseivymiy
kegdvekckedvifnripflecrkenlmngvkqldemnsprivkthlppellpasfwekd
ckiiylcrnakdvavsfyyfflmvaghpnpgsfpefvekfmqgqvpygswykhvkswwek
gksprvlflfyedlkedirkeviklihflerkpseelvdriihhtsfqemknnpstnytt
lpdeimnqklspfmrkgitgdwknhftealnekfdkhyeqqmkestlkfrte
SCOPe Domain Coordinates for d4jvla_:
Click to download the PDB-style file with coordinates for d4jvla_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4jvla_:
- d4jvla_ first appeared in SCOPe 2.03
- d4jvla_ appears in SCOPe 2.05
- d4jvla_ appears in SCOPe 2.07
- d4jvla_ appears in the current release, SCOPe 2.08
View in 3D
