Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins) |
Protein automated matches [190100] (21 species) not a true protein |
Species Burkholderia cenocepacia [TaxId:216591] [196688] (1 PDB entry) |
Domain d4je1b_: 4je1 B: [196689] Other proteins in same PDB: d4je1a2 automated match to d1q98a_ complexed with edo |
PDB Entry: 4je1 (more details), 1.4 Å
SCOPe Domain Sequences for d4je1b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4je1b_ c.47.1.10 (B:) automated matches {Burkholderia cenocepacia [TaxId: 216591]} skvtlggnpidlagtfpavgaqaadfklvgkdladlslasfagkrkvlnivpsldtptca tstrkfneaassldntvvivvsadlpfaatrfctteglanvvtastfrtgrafanaygvd vtsgplngltaravvvldaqdkvihaelvgeikdepnydaalaalk
Timeline for d4je1b_: