Lineage for d4jcla1 (4jcl A:1-407)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2093018Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2095300Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2095301Protein automated matches [190075] (90 species)
    not a true protein
  7. 2095762Species Paenibacillus macerans [TaxId:44252] [256319] (2 PDB entries)
  8. 2095763Domain d4jcla1: 4jcl A:1-407 [252882]
    Other proteins in same PDB: d4jcla2, d4jcla3, d4jcla4
    automated match to d9cgta4
    complexed with ca, cl, edo, gol, peg, pge

Details for d4jcla1

PDB Entry: 4jcl (more details), 1.7 Å

PDB Description: Crystal structure of Alpha-CGT from Paenibacillus macerans at 1.7 Angstrom resolution
PDB Compounds: (A:) cyclomaltodextrin glucanotransferase

SCOPe Domain Sequences for d4jcla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jcla1 c.1.8.0 (A:1-407) automated matches {Paenibacillus macerans [TaxId: 44252]}
spdtsvdnkvnfstdviyqivtdrfadgdrtnnpagdafsgdrsnlklyfggdwqgiidk
indgyltgmgvtalwisqpvenitsvikysgvnntsyhgywardfkqtndafgdfadfqn
lidtahahnikvvidfapnhtspadrdnpgfaenggmydngsllgaysndtaglfhhngg
tdfstiedgiyknlydladinhnnnamdayfksaidlwlgmgvdgirfdavkhmpfgwqk
sfvssiyggdhpvftfgewylgadqtdgdnikfanesgmnlldfeyaqevrevfrdktet
mkdlyevlastesqydyinnmvtfidnhdmdrfqvagsgtrateqalaltltsrgvpaiy
ygteqymtgdgdpnnrammtsfntgttaykviqalaplrksnpaiay

SCOPe Domain Coordinates for d4jcla1:

Click to download the PDB-style file with coordinates for d4jcla1.
(The format of our PDB-style files is described here.)

Timeline for d4jcla1: