Lineage for d4jc4a_ (4jc4 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1860688Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 1861838Superfamily c.56.3: Peptidyl-tRNA hydrolase-like [53178] (2 families) (S)
  5. 1861852Family c.56.3.0: automated matches [193325] (1 protein)
    not a true family
  6. 1861853Protein automated matches [193326] (7 species)
    not a true protein
  7. 1861883Species Pseudomonas aeruginosa [TaxId:208964] [193327] (9 PDB entries)
  8. 1861892Domain d4jc4a_: 4jc4 A: [196750]
    automated match to d2ptha_
    complexed with gol

Details for d4jc4a_

PDB Entry: 4jc4 (more details), 2.25 Å

PDB Description: Crystal structure of Peptidyl-tRNA hydrolase from Pseudomonas aeruginosa at 2.25 angstrom resolution
PDB Compounds: (A:) Peptidyl-tRNA hydrolase

SCOPe Domain Sequences for d4jc4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jc4a_ c.56.3.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
mtavqlivglgnpgpeydqtrhnagalfverlahaqgvslvadrkyfglvgkfshqgkdv
rllipttymnrsgqsvaalagffriapdailvahdeldmppgvaklktggghgghnglrd
iiaqlgnqnsfhrlrlgighpghsslvsgyvlgraprseqelldtsidfalgvlpemlag
dwtramqklhsqka

SCOPe Domain Coordinates for d4jc4a_:

Click to download the PDB-style file with coordinates for d4jc4a_.
(The format of our PDB-style files is described here.)

Timeline for d4jc4a_: