Class a: All alpha proteins [46456] (290 folds) |
Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.8: TPR-like [48452] (11 families) |
Family a.118.8.0: automated matches [191581] (1 protein) not a true family |
Protein automated matches [191037] (12 species) not a true protein |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [256317] (1 PDB entry) |
Domain d4j8eb_: 4j8e B: [252843] automated match to d2buga1 complexed with gol |
PDB Entry: 4j8e (more details), 2.6 Å
SCOPe Domain Sequences for d4j8eb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4j8eb_ a.118.8.0 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} pqemgdenaeiteammdeanekkgaaidalndgelqkaidlftdaiklnprlailyakra svfvklqkpnaairdcdraieinpdsaqpykwrgkahrllghweeaardlalackldyd
Timeline for d4j8eb_: