Lineage for d4j70l_ (4j70 L:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2201124Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2201125Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2201309Family d.153.1.4: Proteasome subunits [56251] (4 protein domains)
  6. 2201421Protein Proteasome alpha subunit (non-catalytic) [56255] (8 species)
    contains an extension to the common fold at the N-terminus
  7. 2201437Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56257] (193 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 2201485Domain d4j70l_: 4j70 L: [193115]
    Other proteins in same PDB: d4j70b_, d4j70c_, d4j70d_, d4j70f_, d4j70g_, d4j70h_, d4j70o_, d4j70p_, d4j70q_, d4j70r_, d4j70t_, d4j70u_, d4j70v_, d4j70w_, d4j70x_, d4j70z_
    automated match to d1jd2s_
    complexed with 1kr

Details for d4j70l_

PDB Entry: 4j70 (more details), 2.8 Å

PDB Description: Yeast 20S proteasome in complex with the belactosin derivative 3e
PDB Compounds: (L:) Proteasome component C5

SCOPe Domain Sequences for d4j70l_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4j70l_ d.153.1.4 (L:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
qfnpygdnggtilgiagedfavlagdtrnitdysinsryepkvfdcgdnivmsangfaad
gdalvkrfknsvkwyhfdhndkklsinsaarniqhllygkrffpyyvhtiiagldedgkg
avysfdpvgsyereqcraggaaaslimpfldnqvnfknqyepgtngkvkkplkylsveev
iklvrdsftsaterhiqvgdgleilivtkdgvrkefyelkrd

SCOPe Domain Coordinates for d4j70l_:

Click to download the PDB-style file with coordinates for d4j70l_.
(The format of our PDB-style files is described here.)

Timeline for d4j70l_: