Lineage for d4isob_ (4iso B:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3032519Fold g.8: BPTI-like [57361] (1 superfamily)
    disulfide-rich alpha+beta fold
  4. 3032520Superfamily g.8.1: BPTI-like [57362] (4 families) (S)
  5. 3032807Family g.8.1.0: automated matches [191505] (1 protein)
    not a true family
  6. 3032808Protein automated matches [190829] (14 species)
    not a true protein
  7. 3032850Species Human (Homo sapiens) [TaxId:9606] [188132] (10 PDB entries)
  8. 3032858Domain d4isob_: 4iso B: [197097]
    Other proteins in same PDB: d4isoa_
    automated match to d1yc0i_
    complexed with gol, gsh, peg, pge

Details for d4isob_

PDB Entry: 4iso (more details), 2.01 Å

PDB Description: crystal structure of matriptase in complex with its inhibitor hai-1
PDB Compounds: (B:) Kunitz-type protease inhibitor 1

SCOPe Domain Sequences for d4isob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4isob_ g.8.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qtedyclasnkvgrcrgsfprwyydpteqicksfvyggclgnknnylreeecilacrgvq

SCOPe Domain Coordinates for d4isob_:

Click to download the PDB-style file with coordinates for d4isob_.
(The format of our PDB-style files is described here.)

Timeline for d4isob_:

3032858
d4isob_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d4isoa_