Lineage for d4irnf1 (4irn F:4-230)

  1. Root: SCOPe 2.03
  2. 1449807Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1451317Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
    2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology
  4. 1451318Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) (S)
    flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)
  5. 1451455Family e.6.1.0: automated matches [227203] (1 protein)
    not a true family
  6. 1451456Protein automated matches [226934] (14 species)
    not a true protein
  7. 1451540Species Oscillatoria sp. [TaxId:272129] [229249] (1 PDB entry)
  8. 1451546Domain d4irnf1: 4irn F:4-230 [229250]
    Other proteins in same PDB: d4irnf2
    automated match to d1ukwa2
    complexed with fad

Details for d4irnf1

PDB Entry: 4irn (more details), 2.8 Å

PDB Description: Crystal Structure of the Prolyl Acyl Carrier Protein Oxidase AnaB
PDB Compounds: (F:) Prolyl-ACP dehydrogenase

SCOPe Domain Sequences for d4irnf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4irnf1 e.6.1.0 (F:4-230) automated matches {Oscillatoria sp. [TaxId: 272129]}
awnsqqiqfrkkviqfaqqslisdlikndkeeifnrdawqkcsefgvhgwpiparyggqe
ldilttayalqglgygckdnglifamnahiwacemplltfgteeqkekylpllcrggwia
shaatepqagsdiyslkttaqkdgdkyilngykhyvtngtiadlfiifatidpslgkegl
ttfmiekdtpglilskpiskmgmrtaevpelrlencevsaanrlgee

SCOPe Domain Coordinates for d4irnf1:

Click to download the PDB-style file with coordinates for d4irnf1.
(The format of our PDB-style files is described here.)

Timeline for d4irnf1:

1451546
d4irnf1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d4irnf2