Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) the beta-sheet barrel is similarly distorted and capped by a C-terminal helix has transition metal ions bound inside the barrel |
Family c.1.9.0: automated matches [191327] (1 protein) not a true family |
Protein automated matches [190150] (36 species) not a true protein |
Species Novosphingobium aromaticivorans [TaxId:279238] [267952] (6 PDB entries) |
Domain d4infa_: 4inf A: [266458] automated match to d3s4ta_ complexed with ca, cl, gol, oxd |
PDB Entry: 4inf (more details), 1.48 Å
SCOPe Domain Sequences for d4infa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4infa_ c.1.9.0 (A:) automated matches {Novosphingobium aromaticivorans [TaxId: 279238]} mtqdlktggeqgylriateeafatreiidvylrmirdgtadkgmvslwgfyaqspserat qilerlldlgerriadmdatgidkailaltspgvqplhdldeartlatrandtladacqk ypdrfigmgtvapqdpewsareihrgarelgfkgiqinshtqgryldeeffdpifralve vdqplyihpatspdsmidpmleagldgaifgfgvetgmhllrlitigifdkypslqimvg hmgealpywlyrldymhqagvrsqryermkplkktiegylksnvlvtnsgvawepaikfc qqvmgedrvmyamdypyqyvadevramdamdmsaqtkkkffqtnaekwfkl
Timeline for d4infa_: