Lineage for d4ijrc_ (4ijr C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829136Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 2829673Family c.1.7.0: automated matches [191491] (1 protein)
    not a true family
  6. 2829674Protein automated matches [190793] (31 species)
    not a true protein
  7. 2829690Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [229247] (2 PDB entries)
  8. 2829692Domain d4ijrc_: 4ijr C: [229248]
    automated match to d2fvla_
    complexed with ndp

Details for d4ijrc_

PDB Entry: 4ijr (more details), 2 Å

PDB Description: Crystal structure of Saccharomyces cerevisiae arabinose dehydrogenase Ara1 complexed with NADPH
PDB Compounds: (C:) D-arabinose dehydrogenase [NAD(P)+] heavy chain

SCOPe Domain Sequences for d4ijrc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ijrc_ c.1.7.0 (C:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
mlhpktteiyfslnngvripalglgtanpheklaetkqavkaaikagyrhidtawayete
pfvgeaikelledgsikredlfittkvwpvlwdevdrslneslkalgleyvdlllqhwpl
cfekikdpkgisglvktpvddsgktmyaadgdyletykqlekiyldpndhrvraigvsnf
sieylerlikecrvkptvnqvethphlpqmelrkfcfmhdilltaysplgshgapnlkip
lvkklaekynvtgndllisyhirqgtiviprslnpvrisssiefasltkdelqelndfge
kypvrfidepfaailpeftgngpnldnl

SCOPe Domain Coordinates for d4ijrc_:

Click to download the PDB-style file with coordinates for d4ijrc_.
(The format of our PDB-style files is described here.)

Timeline for d4ijrc_: