Lineage for d4ibxb_ (4ibx B:)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2244155Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2244156Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2244157Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 2244418Protein beta-Lactamase, class A [56606] (16 species)
  7. 2244449Species Escherichia coli, TEM-1 [TaxId:562] [56607] (59 PDB entries)
  8. 2244539Domain d4ibxb_: 4ibx B: [196860]
    automated match to d1zg4a1
    complexed with ca, mes, so4

Details for d4ibxb_

PDB Entry: 4ibx (more details), 2.68 Å

PDB Description: Crystal structure of stabilized TEM-1 beta-lactamase variant v.13
PDB Compounds: (B:) Beta-lactamase TEM

SCOPe Domain Sequences for d4ibxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ibxb_ e.3.1.1 (B:) beta-Lactamase, class A {Escherichia coli, TEM-1 [TaxId: 562]}
hpetlvkvkdaedqlggrvgyieldlasgkilesfrpeerfpmmstfkvllcgavlsrvd
agqeqlgrrihysqndlveyspvtekhltdgmtvgelcsaaitmsdntaanlllttiggp
keltaflhnmgdhvtrldrwepelneaipnderdtttpvamattlrklltgelltaasrq
qlidwmeadkvagpllrsalpagwfiadksgagergsrgiiaalgpdgkpsrivviymtg
sqatmdernrqiaeigaslikhw

SCOPe Domain Coordinates for d4ibxb_:

Click to download the PDB-style file with coordinates for d4ibxb_.
(The format of our PDB-style files is described here.)

Timeline for d4ibxb_: