Lineage for d4i7zg_ (4i7z G:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2631663Superfamily f.23.26: PetG subunit of the cytochrome b6f complex [103446] (1 family) (S)
  5. 2631664Family f.23.26.1: PetG subunit of the cytochrome b6f complex [103447] (2 proteins)
  6. 2631675Protein automated matches [196847] (1 species)
    not a true protein
  7. 2631676Species Mastigocladus laminosus [TaxId:83541] [196848] (5 PDB entries)
  8. 2631680Domain d4i7zg_: 4i7z G: [196849]
    Other proteins in same PDB: d4i7za_, d4i7zb_, d4i7zc1, d4i7zc2, d4i7zc3, d4i7ze_, d4i7zf_, d4i7zh_
    automated match to d2e74g1
    complexed with 1e2, 8k6, bcr, cd, cla, hem, mys, oct, oz2, umq

Details for d4i7zg_

PDB Entry: 4i7z (more details), 2.8 Å

PDB Description: crystal structure of cytochrome b6f in dopg, with disordered rieske iron-sulfur protein soluble domain
PDB Compounds: (G:) Cytochrome b6-f complex subunit 5

SCOPe Domain Sequences for d4i7zg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i7zg_ f.23.26.1 (G:) automated matches {Mastigocladus laminosus [TaxId: 83541]}
eplldglvlglvfatlgglfyaayqqykrpnelgg

SCOPe Domain Coordinates for d4i7zg_:

Click to download the PDB-style file with coordinates for d4i7zg_.
(The format of our PDB-style files is described here.)

Timeline for d4i7zg_: