![]() | Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
![]() | Superfamily f.23.26: PetG subunit of the cytochrome b6f complex [103446] (1 family) ![]() |
![]() | Family f.23.26.1: PetG subunit of the cytochrome b6f complex [103447] (2 proteins) |
![]() | Protein automated matches [196847] (1 species) not a true protein |
![]() | Species Mastigocladus laminosus [TaxId:83541] [196848] (5 PDB entries) |
![]() | Domain d4i7zg_: 4i7z G: [196849] Other proteins in same PDB: d4i7za_, d4i7zb_, d4i7zc1, d4i7zc2, d4i7zc3, d4i7ze_, d4i7zf_, d4i7zh_ automated match to d2e74g1 complexed with 1e2, 8k6, bcr, cd, cla, hem, mys, oct, oz2, umq |
PDB Entry: 4i7z (more details), 2.8 Å
SCOPe Domain Sequences for d4i7zg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4i7zg_ f.23.26.1 (G:) automated matches {Mastigocladus laminosus [TaxId: 83541]} eplldglvlglvfatlgglfyaayqqykrpnelgg
Timeline for d4i7zg_: