Class a: All alpha proteins [46456] (289 folds) |
Fold a.157: Skp1 dimerisation domain-like [81384] (1 superfamily) multihelical; interlocked heterodimer with F-box proteins |
Superfamily a.157.1: Skp1 dimerisation domain-like [81382] (2 families) automatically mapped to Pfam PF01466 |
Family a.157.1.1: Skp1 dimerisation domain-like [81380] (3 proteins) |
Protein automated matches [226933] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225235] (6 PDB entries) |
Domain d4i6jc2: 4i6j C:85-162 [222960] Other proteins in same PDB: d4i6ja1, d4i6jc1 automated match to d1p22b1 |
PDB Entry: 4i6j (more details), 2.7 Å
SCOPe Domain Sequences for d4i6jc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4i6jc2 a.157.1.1 (C:85-162) automated matches {Human (Homo sapiens) [TaxId: 9606]} ipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpeeirktfniknd fteeeeaqvrkenqwcee
Timeline for d4i6jc2: