Lineage for d4i5be1 (4i5b E:2-92)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2544619Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2544620Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2544621Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2545431Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)
  7. 2545441Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [88821] (20 PDB entries)
  8. 2545453Domain d4i5be1: 4i5b E:2-92 [229427]
    Other proteins in same PDB: d4i5ba1, d4i5ba2, d4i5bb2, d4i5bd1, d4i5bd2, d4i5be2
    automated match to d1klub2

Details for d4i5be1

PDB Entry: 4i5b (more details), 2.12 Å

PDB Description: structure of human mhc class ii protein hla-dr1 carrying an influenza hemagglutinin peptide partially filling the binding groove
PDB Compounds: (E:) HLA class II histocompatibility antigen, DRB1-1 beta chain

SCOPe Domain Sequences for d4i5be1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i5be1 d.19.1.1 (E:2-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR1 [TaxId: 9606]}
dtrprflwqlkfechffngtervrllersiynqeesvrfdsdvgeyravtelgrpdaeyw
nsqkdlleqrraavdtycrhnygvgesftvq

SCOPe Domain Coordinates for d4i5be1:

Click to download the PDB-style file with coordinates for d4i5be1.
(The format of our PDB-style files is described here.)

Timeline for d4i5be1: