Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species) |
Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88621] (37 PDB entries) Uniprot P01903 28-207 probably orthologous to the mouse I-E group |
Domain d4i5bd2: 4i5b D:82-188 [229425] Other proteins in same PDB: d4i5ba1, d4i5bb1, d4i5bb2, d4i5bd1, d4i5be1, d4i5be2 automated match to d1fv1a1 |
PDB Entry: 4i5b (more details), 2.12 Å
SCOPe Domain Sequences for d4i5bd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4i5bd2 b.1.1.2 (D:82-188) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]} itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre dhlfrkfhylpflpstedvydcrvehwgldepllkhwefdapsplpe
Timeline for d4i5bd2: