Class a: All alpha proteins [46456] (290 folds) |
Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily a.137.10: Stathmin [101494] (1 family) single long helix crosslinking four tubulin subunits automatically mapped to Pfam PF00836 |
Family a.137.10.1: Stathmin [101495] (2 proteins) |
Protein Stathmin 4 [101496] (3 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (186 PDB entries) |
Domain d4i4te_: 4i4t E: [222913] Other proteins in same PDB: d4i4ta1, d4i4ta2, d4i4tb1, d4i4tb2, d4i4tc1, d4i4tc2, d4i4td1, d4i4td2, d4i4tf1, d4i4tf2, d4i4tf3 automated match to d4ihje_ complexed with acp, ca, cl, gdp, gol, gtp, mes, mg, tyr, zpn |
PDB Entry: 4i4t (more details), 1.8 Å
SCOPe Domain Sequences for d4i4te_:
Sequence, based on SEQRES records: (download)
>d4i4te_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]} mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe kdkhaeevrknkelkeea
>d4i4te_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]} mevielnkctsgqsfevilkppsdpsleeiqkkleaaeerrkyqeaellkhlaekreher eviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelk eea
Timeline for d4i4te_: