Lineage for d4i24a_ (4i24 A:)
- Root: SCOPe 2.03
Class d: Alpha and beta proteins (a+b) [53931] (376 folds) 
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
consists of two alpha+beta domains, C-terminal domain is mostly alpha helicalSuperfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) 
shares functional and structural similarities with the ATP-grasp fold and PIPKFamily d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
members organized in the groups and subfamiles specified by the comments
Protein EGF receptor tyrosine kinase, Erbb-1 [82795] (1 species)
PTK group; EGFR subfamily; membrane spanning protein tyrosine kinaseSpecies Human (Homo sapiens) [TaxId:9606] [82796] (38 PDB entries)
Uniprot P00533 702-1018
Domain d4i24a_: 4i24 A: [193289]
automated match to d1m14a_
complexed with 1c9
Details for d4i24a_
PDB Entry: 4i24 (more details), 1.8 Å
PDB Description: Structure of T790M EGFR kinase domain co-crystallized with dacomitinib
PDB Compounds: (A:) Epidermal growth factor receptorSCOPe Domain Sequences for d4i24a_:
Sequence, based on SEQRES records: (download)
>d4i24a_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]}
nqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatspkankei
ldeayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigsqyllnwcv
qiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyhaeggkvpik
wmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpqppic
tidvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdermhlpsptdsnfyr
almdeedmddvvdad
Sequence, based on observed residues (ATOM records): (download)
>d4i24a_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]}
nqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelankeildeayvm
asvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigsqyllnwcvqiakgmn
yledrrlvhrdlaarnvlvktpqhvkitdfglakllvpikwmalesilhriythqsdvws
ygvtvwelmtfgskpydgipaseissilekgerlpqppictidvymimvkcwmidadsrp
kfreliiefskmardpqrylviqgdermhlpsptdsnfyralmdeedmddvvdad
SCOPe Domain Coordinates for d4i24a_:
Click to download the PDB-style file with coordinates for d4i24a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4i24a_:
- d4i24a_ first appeared in SCOPe 2.02
- d4i24a_ appears in SCOPe 2.04
- d4i24a_ appears in the current release, SCOPe 2.08
View in 3D
