Lineage for d4i1ub_ (4i1u B:)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
3 layers: a/b/a, parallel or mixed beta-sheets of variable sizesSuperfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) 
division into families based on beta-sheet topologies
Family c.37.1.0: automated matches [191323] (1 protein)
not a true familyProtein automated matches [190123] (96 species)
not a true protein
Species Burkholderia vietnamiensis [TaxId:269482] [194164] (2 PDB entries) 
Domain d4i1ub_: 4i1u B: [194165]
automated match to d1vhta_
complexed with cl, edo, so4
Details for d4i1ub_
PDB Entry: 4i1u (more details), 2.05 Å
PDB Description: Apo crystal structure of a dephospho-CoA kinase from Burkholderia vietnamiensis
PDB Compounds: (B:) dephospho-coa kinaseSCOPe Domain Sequences for d4i1ub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4i1ub_ c.37.1.0 (B:) automated matches {Burkholderia vietnamiensis [TaxId: 269482]}
hmyaigltggigsgkttvadlfaargaslvdtdliahritapaglampaieqtfgpafva
adgsldrarmralifsdedarrrleaithpliraetereardaqgpyvifvvpllvesrn
wkarcdrvlvvdcpvdtqiarvmqrngftreqveaiiarqatrearlaaaddvivndaat
pdalavqvdalhqrylafaaak
SCOPe Domain Coordinates for d4i1ub_:
Click to download the PDB-style file with coordinates for d4i1ub_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4i1ub_:
- d4i1ub_ first appeared in SCOPe 2.02
- d4i1ub_ appears in SCOPe 2.04
- d4i1ub_ is called d4i1ub1 in SCOPe 2.06
- d4i1ub_ appears in the current release, SCOPe 2.08, called d4i1ub1
View in 3D
