Lineage for d4i1ub_ (4i1u B:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1593542Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1593543Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1597921Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 1597922Protein automated matches [190123] (79 species)
    not a true protein
  7. 1598009Species Burkholderia vietnamiensis [TaxId:269482] [194164] (2 PDB entries)
  8. 1598011Domain d4i1ub_: 4i1u B: [194165]
    automated match to d1vhta_
    complexed with cl, edo, so4

Details for d4i1ub_

PDB Entry: 4i1u (more details), 2.05 Å

PDB Description: Apo crystal structure of a dephospho-CoA kinase from Burkholderia vietnamiensis
PDB Compounds: (B:) dephospho-coa kinase

SCOPe Domain Sequences for d4i1ub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i1ub_ c.37.1.0 (B:) automated matches {Burkholderia vietnamiensis [TaxId: 269482]}
hmyaigltggigsgkttvadlfaargaslvdtdliahritapaglampaieqtfgpafva
adgsldrarmralifsdedarrrleaithpliraetereardaqgpyvifvvpllvesrn
wkarcdrvlvvdcpvdtqiarvmqrngftreqveaiiarqatrearlaaaddvivndaat
pdalavqvdalhqrylafaaak

SCOPe Domain Coordinates for d4i1ub_:

Click to download the PDB-style file with coordinates for d4i1ub_.
(The format of our PDB-style files is described here.)

Timeline for d4i1ub_: