Lineage for d4hzfb2 (4hzf B:139-209)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694554Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2694555Protein automated matches [190154] (92 species)
    not a true protein
  7. 2694708Species Escherichia coli K-12 [TaxId:83333] [225713] (14 PDB entries)
  8. 2694714Domain d4hzfb2: 4hzf B:139-209 [228637]
    Other proteins in same PDB: d4hzfa1, d4hzfb1
    automated match to d1hw5a1
    complexed with cmp, gol, po4

Details for d4hzfb2

PDB Entry: 4hzf (more details), 1.48 Å

PDB Description: structure of the wild type Catabolite gene Activator Protein
PDB Compounds: (B:) Catabolite gene activator

SCOPe Domain Sequences for d4hzfb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hzfb2 a.4.5.0 (B:139-209) automated matches {Escherichia coli K-12 [TaxId: 83333]}
dvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsretvgrilkmledqnlis
ahgktivvygt

SCOPe Domain Coordinates for d4hzfb2:

Click to download the PDB-style file with coordinates for d4hzfb2.
(The format of our PDB-style files is described here.)

Timeline for d4hzfb2:

2694714
d4hzfb2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d4hzfb1