Lineage for d4hzfb1 (4hzf B:10-138)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2080271Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2082002Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) (S)
  5. 2082008Family b.82.3.2: cAMP-binding domain [51210] (13 proteins)
    Pfam PF00027
  6. 2082153Protein automated matches [190352] (8 species)
    not a true protein
  7. 2082154Species Escherichia coli K-12 [TaxId:83333] [225712] (8 PDB entries)
  8. 2082160Domain d4hzfb1: 4hzf B:10-138 [228636]
    Other proteins in same PDB: d4hzfa2, d4hzfb2
    automated match to d1hw5a2
    complexed with cmp, gol, po4

Details for d4hzfb1

PDB Entry: 4hzf (more details), 1.48 Å

PDB Description: structure of the wild type Catabolite gene Activator Protein
PDB Compounds: (B:) Catabolite gene activator

SCOPe Domain Sequences for d4hzfb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hzfb1 b.82.3.2 (B:10-138) automated matches {Escherichia coli K-12 [TaxId: 83333]}
ptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkemilsylnqgd
figelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlsaqmarrlqvts
ekvgnlafl

SCOPe Domain Coordinates for d4hzfb1:

Click to download the PDB-style file with coordinates for d4hzfb1.
(The format of our PDB-style files is described here.)

Timeline for d4hzfb1:

2082160
d4hzfb1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d4hzfb2