Lineage for d4hwra1 (4hwr A:242-532)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
contains large mixed beta-sheetSuperfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) 
Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins) Protein automated matches [193659] (8 species)
not a true protein
Species Escherichia coli K-12 [TaxId:83333] [227935] (6 PDB entries) 
Domain d4hwra1: 4hwr A:242-532 [234711]
Other proteins in same PDB: d4hwra2, d4hwra3, d4hwra4
automated match to d4hwpb1
protein/RNA complex; complexed with 1b2, zn
Details for d4hwra1
PDB Entry: 4hwr (more details), 1.9 Å
PDB Description: Crystal structure of E. coli Threonyl-tRNA synthetase bound to a novel inhibitor
PDB Compounds: (A:) Threonine--tRNA ligaseSCOPe Domain Sequences for d4hwra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hwra1 d.104.1.1 (A:242-532) automated matches {Escherichia coli K-12 [TaxId: 83333]}
rdhrkigkqldlyhmqeeapgmvfwhndgwtifrelevfvrsklkeyqyqevkgpfmmdr
vlwektghwdnykdamfttssenreycikpmncpghvqifnqglksyrdlplrmaefgsc
hrnepsgslhglmrvrgftqddahifcteeqirdevngcirlvydmystfgfekivvkls
trpekrigsdemwdraeadlavaleennipfeyqlgegafygpkieftlydcldrawqcg
tvqldfslpsrlsasyvgednerkvpvmihrailgsmerfigilteefagf
SCOPe Domain Coordinates for d4hwra1:
Click to download the PDB-style file with coordinates for d4hwra1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4hwra1:
- d4hwra1 first appeared in SCOPe 2.03
- d4hwra1 appears in SCOPe 2.07
View in 3D
